FOX04 - DRI Nasal Spray

£206.99£406.98

Molecular Formula: C228H388N86O64
Molecular Weight: 5358.05 g/mol

Clear
SKU FOX04 - DRI Nasal Spray Categories ,

Description

FOX04 – DRI Nasal Spray

Medical research show this substance to be a beneficial product for treating hair loss. This peptide has delivered results to help with loss of hair treatment.

Source: https://www.uniprot.org/uniprot/P98177 | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7053614/

Molecular Formula: C228H388N86O64
Sequence: H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKRG-OH
Molecular Weight: 5358.05 g/mol
Physical Appearance: White Lyophilised Solid
Form: Sterile Filtered White Lyophilized
Solubility: Water Soluble

Storage: Peptides should be refrigerated at 4˚C or below for a period of up to 3 months. To prolong the life span of the peptides they may be placed in a freezer for up to 12 months. Once reconstituted peptides should be refrigerated/stored at 4˚C for up to 30 days.

Additional information

Size

15ml, 25ml

You may also like…