Menu

  • 1st time order get 10% Discount
  • Buy 5 get 5% Discount
  • Buy 10 get 10% Discount
  • Spend over £200 + get FREE Delivery
  • Pay by crypto get 10% discount

FOX04 – DRI Nasal Spray

£205.00£405.00

Molecular Formula: C228H388N86O64
Molecular Weight: 5358.05 g/mol

Clear
SKU: FOX04 - DRI Nasal Spray Category:

Description

Source: https://www.uniprot.org/uniprot/P98177

Molecular Formula: C228H388N86O64
Sequence: H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKRG-OH
Molecular Weight: 5358.05 g/mol

You may also like…

Select Your currency
GBPPound sterling
EUR Euro