Change Currency

Sale!

FOX04 - DRI

£151.99

Molecular Formula: C228H388N86O64
Molecular Weight: 5358.05 g/mol

Clear
SKU FOX04 - DRI Categories , ,

Description

FOX04 – DRI

Molecular Formula: C228H388N86O64
Sequence: H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKRG-OH
Molecular Weight: 5358.05 g/mol
Physical Appearance: White Lyophilised Solid
Form: Sterile Filtered White Lyophilized
Solubility: Water Soluble
Storage: Store at -20˚C

Disclaimer:

All products listed on this website and provided through Pharma Lab Global are intended for medical research purposes only. Pharma Lab Global does not encourage or promote the use of any of these products in a personal capacity (i.e. human consumption), nor are the products intended to be used as a drug, stimulant or for use in any food products.

Additional information

Size

10mg

You may also like…