Menu

  • 1st time order get 10% Discount
  • Buy 5 get 5% Discount
  • Buy 10 get 10% Discount
  • Spend over £200 + get FREE Delivery
  • Pay by crypto get 10% discount

FOX04 – DRI

£190.99

Molecular Formula: C228H388N86O64
Molecular Weight: 5358.05 g/mol

Clear
SKU: FOX04 - DRI Category:

Description

Source: https://www.uniprot.org/uniprot/P98177

Molecular Formula: C228H388N86O64
Sequence: H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKRG-OH
Molecular Weight: 5358.05 g/mol
Physical Appearance: White Lyophilised Solid
Form: Sterile Filtered White Lyophilized
Solubility: Water Soluble

Storage: Peptides should be refrigerated at 4˚C or below for a period of up to 3 months. To prolong the life span of the peptides they may be placed in a freezer for up to 12 months. Once reconstituted peptides should be refrigerated/stored at 4˚C for up to 30 days.

You may also like…

Select Your currency
GBPPound sterling
EUR Euro