Change Currency

Sale!

GLP-1

£16.99£97.99

GLP-1 is known to be insulin-stimulating. GLP-1 has an effect on insulin release. This effect helps to trigger the glucose-stimulated insulin secretory response.

Clear
SKU AMPK 10MG-1 Categories , ,

Description

GLP-1 Peptide Vial 2mg

GLP-1 is known to be insulin-stimulating. GLP-1 has an effect on insulin release. This effect helps to trigger the glucose-stimulated insulin secretory response.

GLP-1 agonists promote glycemic insulin secretion, slow stomach motility, increase early satiety and decrease glucagon level following meals and thus have hypoglycemic effects even after intravenous administration, without hypoglycemia. Glucagon-like peptide 1 (GLP-1) can be used to regulate the appetite after a meal. It also leads to an increase in insulin production. GLP-1 is made in the intestine. The primary source of GLP-1 are the cells in the small intestine.

In pharmacological doses, GLP-1 agonising infusion improved satiation and increased weight loss. GLP-1 therapy decreases human eating, appetite and hunger and encourages fullness and satiety as a result of weight loss.

Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG

Molecular Formula: C172H265N43051

Molecular Weight: 3751.24 g/mol

Disclaimer: All products listed on this website and provided through Pharma Labs Global are intended for medical research purposes only. Pharma Lab Global does not encourage or promote the use of any of these products in a personal capacity (i.e. human consumption), nor are the products intended to be used as a drug, stimulant or for use in any food products.

Additional information

Size

2mg, 10mg

You may also like…