(£)
GBP (Default)
- ($) USD
- (€) EUR
- ($) AUD
- ($) CAD
- ($) NZD
15% off first order with code: 1storder
99%+ Quality Guaranteed
Pay by crypto get 10% discount
Shipping Protection
Fast Order Process
IGF-1 LR3, additionally called LR3-IGF-1, is an extended and customized variation of naturally developing IGF-1. In contrast to IGF-1, IGF-1 LR3 consists of 13 additional amino acids as well as it has the amino acid arginine replaced ready 3.
£26.50 – £108.03
The product itself is made from all-natural ingredients that have been proven to be safe for use. It is the combination of two natural amino acids that act as an anti-oxidant and increase the rate at which muscle growth occurs.
It stimulates an increased rate of testosterone that allows for more growth in muscle. As you probably already know, testosterone is the primary male sex hormone responsible for keeping muscles growing. When the levels of testosterone increase, so do the size of the muscle tissue.
As you can see, IGF-1 LR3 is different from the human growth hormone. While they are similar in some regards, this new product works a lot different than the traditional way in which it is produced.
What is IGF-1 LR3?
Insulin-like Growth Factor-1 Long Arginine 3, also known as IGF-1 LR3, is a modified, synthetic version of insulin-like Growth Factor-1. IGF1 LR3 remains active up to 120 times longer than conventional IGF-1 because it does not bind effectively to IGF-1-binding proteins. This increases the peptide’s half-life and hence its activity. By stopping myostatin from working, IGF-1 LR3 helps cells divide and grow, speeds up fat metabolism, and speeds up muscle repair and growth (hypertrophy). Recent research shows that IGF-1 LR3 may also help nursing mothers make more milk.
Molecular Formula: C400H625N111O115S9
Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDEC CFRSCDLRRLEMYCAPLKPA KSA
Molecular Weight: 9117.5 g/mol
Physical Appearance: White Lyophilised Solid
Form: Sterile Filtered White Lyophilized
Solubility: Water Soluble
Storage: -19˚C
Size: 0.1mg | 1mg
Insulin-like Growth Factor-1 Long Arginine 3, also known as IGF1 LR3, is a modified, synthetic version of insulin-like Growth Factor-1. IGF-1 LR3 remains active up to 120 times longer than conventional IGF-1 because it does not bind effectively to IGF-1-binding proteins. This increases the peptide’s half-life and hence its activity. By stopping myostatin from working, IGF-1 LR3 helps cells divide and grow, speeds up fat metabolism, and speeds up muscle repair and growth (hypertrophy). Recent research shows that IGF-1 LR3 may also help nursing mothers make more milk.
Cell Divison Like IGF-1
IGF1-LR3 is a powerful stimulant of cell proliferation and division. However, it also increases cell division in the kidney, liver, skin, nerve, blood, and lung tissues. IGF-1 is best understood as a hormone for maturation because it helps cells grow and change. In other words, IGF-1 helps cells mature to perform their specific duties.
IGF1-LR3, unlike IGF-1, stays in the bloodstream for extended periods. This attribute renders IGF1-LR3 a far more powerful molecule. IGF1-LR3 stimulates cells roughly three times more than IGF-1. IGF1-LR3 and all other IGF-1 derivatives don’t cause cells to grow bigger (hypertrophy). Instead, they cause cells to divide and multiply (hyperplasia). In the case of muscle, for example, IGF1-LR3 does not increase the size of muscle cells but increases the overall number of muscle cells.
Diabetes and Fat Metabolism
IGF1-LR3 indirectly accelerates the breakdown of fat by attaching to both the insulin receptor and the IGF-1R receptor. These actions stimulate muscular, neuronal, and hepatic cells to absorb glucose from the bloodstream. This causes a dip in blood sugar, causing the liver and fat cells to break down glycogen and triglycerides. This leads to an overall decrease in adipose tissue and an increase in energy consumption (i.e. net catabolism).
IGF1-LR3 decreases insulin levels and the need for extra insulin in diabetics, which is not surprising given that it lowers blood sugar levels. This often leads to a 10% reduction in the amount of insulin used to maintain the same blood sugar levels. This discovery could aid scientists in understanding how to minimise insulin doses in individuals with low insulin sensitivity and shed light on preventing type 2 diabetes.
Reduces Myostatin
Myostatin (also known as GDF-8) is a muscle protein that predominantly inhibits muscle cell development and differentiation. Even though this function is important for preventing uncontrolled hypertrophy and making sure that injuries heal properly, there are times when blocking myostatin could be helpful. In situations such as Duchenne muscular dystrophy (DMD) or in persons who experience muscle loss due to extended immobilisation, the ability to inhibit myostatin’s action could be advantageous. Inhibiting this natural enzyme could delay muscle breakdown, preserve strength, and prevent disease.
In mouse models of Duchenne muscular dystrophy, it has been found that IGF1-LR3 and other IGF-1 analogues can prevent muscle cells from dying and stop apoptosis by counteracting the effects of myostatin. Due to its long half-life, IGF1-LR3 is particularly effective at countering myostatin and appears to function by activating a muscle protein known as MyoD [1], [2]. MyoD is the protein typically triggered by activity (e.g., weightlifting) or tissue injury and is responsible for muscle growth.
Research in Longevity
IGF1-LR3 promotes tissue preservation and repair throughout the body, making it a protective peptide against cell damage and ageing. Research on cows and swine suggests that IGF1-LR3 treatment may be an effective method for counteracting the ageing effects of cells. Ongoing studies on mice aim to establish if IGF1-LR3 might be effective in delaying the advancement of various diseases, including dementia, muscular atrophy, and renal disease. This study demonstrates that administering IGF-1 can extend life span and decrease disability. [3], [4], [5]
Glucocorticoid Signaling
Glucocorticoids, largely released by the adrenal glands, are essential clinical medications used to regulate pain and reduce inflammation in autoimmune illnesses, neurological injuries, cancer, and other conditions. Unfortunately, glucocorticoids have a number of unpleasant side effects, including muscle atrophy, weight gain, and loss of bone density. There is some interest in utilising IGF1-LR3 to decrease the negative effects of glucocorticoids and enable more effective therapy. [6]
According to animal studies, the IGF-1 LR3 peptide has shown the following benefits:
Pharma Lab Global is one of the best locations to purchase high purity IGF1 LR3 for research. Pharma Lab Global is a trusted supplier of peptides and sarms worldwide. You have the option to buy IGF1-LR3 Nasal Spray and buy IGF1-LR3 Pre Mixed peptide from here. Buy from Pharma Lab Global today!
TO PURCHASE PRODUCTS FROM OUR WEBSITE YOU MUST BE AT LEAST 21 YEARS OF AGE.
DISCLAIMER: All products sold by PharmaLabGlobal are for in-vitro research and laboratory use only. These products are not designed for use or consumption by humans or animals. Nothing on this Website is intended to diagnose, heal, treat, cure, mitigate or prevent disease. By purchasing from our Website the buyer accepts and acknowledges the risks involved with consumption and handling of these products. All articles and product information provided on this Website are for informational and educational purposes only. All products are to be handled by qualified and properly trained research or laboratory professionals only.
| Weight | 0.01 kg |
|---|---|
| Dimensions | 1 × 1 × 1 cm |
| Size | 0.1mg Vial, 1mg Vial, Kit = 0.1mg vial, bac water, syringes, Kit = 1mg vial, bac water, syringes |
TO PURCHASE PRODUCTS FROM OUR WEBSITE YOU MUST BE AT LEAST 21 YEARS OF AGE.
DISCLAIMER: All products sold by Pharma Lab Global are for in-vitro research and laboratory use only. These products are not designed for use or consumption by humans or animals. Nothing on this Website is intended to diagnose, heal, treat, cure, mitigate or prevent disease. By purchasing from our Website the buyer accepts and acknowledges the risks involved with consumption and handling of these products. All articles and product information provided on this Website are for informational and educational purposes only. All products are to be handled by qualified and properly trained research or laboratory professionals only.
