Description
IGF-1 LR3 Peptide Vial
The product itself is made from all-natural ingredients that have been proven to be safe for use. It is the combination of two natural amino acids that act as an anti-oxidant and increase the rate at which muscle growth occurs.
It stimulates an increased rate of testosterone that allows for more growth in muscle. As you probably already know, testosterone is the primary male sex hormone responsible for keeping muscles growing. When the levels of testosterone increase, so do the size of the muscle tissue.
As you can see, IGF-1 LR3 is different from the human growth hormone. While they are similar in some regards, this new product works a lot different than the traditional way in which it is produced.
IGF-1 LR3 Specifications
Molecular Formula: C400H625N111O115S9
Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDEC CFRSCDLRRLEMYCAPLKPA KSA
Molecular Weight: 9117.5 g/mol
Physical Appearance: White Lyophilised Solid
Form: Sterile Filtered White Lyophilized
Solubility: Water Soluble
Storage: -19˚C
Disclaimer: All products listed on this website and provided through Pharma Labs Global are intended for medical research purposes only. Pharma Lab Global does not encourage or promote the use of any of these products in a personal capacity (i.e. human consumption), nor are the products intended to be used as a drug, stimulant or for use in any food products.